PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00098203001
Common NameGSBRNA2T00098203001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 224aa    MW: 24736.2 Da    PI: 7.0522
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00098203001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof111.24.8e-352077461
               zf-Dof  4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                          a+ cprC+s+ntkfCyynnys sqPry Ck+CrryWt+GG+lrnvP+Gg+ rk k++
  GSBRNA2T00098203001 20 PARVCPRCNSDNTKFCYYNNYSASQPRYKCKNCRRYWTHGGTLRNVPIGGSGRKIKRN 77
                         5789**************************************************8875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-241676IPR003851Zinc finger, Dof-type
PfamPF027012.4E-312276IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.4472276IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102460IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MDYSGLFVED DNQVNEEKPP ARVCPRCNSD NTKFCYYNNY SASQPRYKCK NCRRYWTHGG  60
TLRNVPIGGS GRKIKRNRLD QPSFSQVISV ENQQVNHHQP LLHDQETNEF VGSSSSSAAV  120
VGGNHFGSLP EFHGDMVTNV PPFGSFPPME ALHITDVSLQ QGYYDAGSSD LIGNPLVKQL  180
TGGSVVVSSD QEDPNMWNQS FNNTTNMNHN ASTSGGKRHI SKH*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1728782e-58AC172878.1 Brassica rapa subsp. oleifera cultivar Inbred line 'Chiifu' clone KBrH069E01, complete sequence.
GenBankAC2410202e-58AC241020.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB039B11, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013594711.11e-168PREDICTED: dof zinc finger protein DOF4.4-like
SwissprotQ9SUA98e-74DOF44_ARATH; Dof zinc finger protein DOF4.4
TrEMBLA0A078JV941e-168A0A078JV94_BRANA; BnaCnng67920D protein
TrEMBLA0A0D3A4Q61e-168A0A0D3A4Q6_BRAOL; Uncharacterized protein
STRINGBra013494.1-P1e-156(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16021789
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21050.17e-71Dof-type zinc finger domain-containing protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]